PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013625230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 304aa    MW: 33403.1 Da    PI: 6.521
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013625230.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.44.3e-201358147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEdell  +v+++G+++W++I++ ++ gR++k+c++rw + 
   XP_013625230.1 13 KGPWSPEEDELLQSLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 58
                     79******************************.***********985 PP

2Myb_DNA-binding54.42.8e-1767109347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++eEde +v+a+++lG++ W+tI+r +  gRt++ +k++w++ 
   XP_013625230.1  67 AFSPEEDETIVRAHARLGNK-WATISRLLS-GRTDNAIKNHWNST 109
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.151863IPR017930Myb domain
SuperFamilySSF466891.91E-3110106IPR009057Homeodomain-like
SMARTSM007171.4E-171261IPR001005SANT/Myb domain
PfamPF002498.3E-201358IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-261466IPR009057Homeodomain-like
CDDcd001671.44E-161557No hitNo description
SMARTSM007171.7E-1364112IPR001005SANT/Myb domain
PROSITE profilePS5129420.19765114IPR017930Myb domain
PfamPF002493.3E-1467109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.3E-2267113IPR009057Homeodomain-like
CDDcd001671.71E-1067110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MSSSVRKNME RIKGPWSPEE DELLQSLVQK HGPRNWSLIS KSIPGRSGKS CRLRWCNQLS  60
PEVEHRAFSP EEDETIVRAH ARLGNKWATI SRLLSGRTDN AIKNHWNSTL KRKCSAVTSD  120
GHDGNFGEEQ PLKRTASGGG VSTELYMSPR SPSGSDVSEQ SGGGPHVFRS GAVNEMTASS  180
SGEDPPTYLS LSPPWNNRCE TETVRVNEST QLNEDTVIDG GYTAELFPVR KEEVEEGQGI  240
SGFGGEFMTV VQEMIRTEVR SYMADLQRGN IGGGGGSCMP QSVNNRRVGF REFIVNQIGI  300
GKIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-41101141105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667421e-128KC966742.1 Brassica napus MYB transcription factor 73 (MYB73.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013625230.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW12e-88MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D3BJV10.0A0A0D3BJV1_BRAOL; Uncharacterized protein
STRINGBra010593.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-172myb domain protein 73